Multimer Prediction and Protein Complexes

AlphaFold2-Multimer extends the power of structure prediction to protein complexes, enabling you to model protein-protein interactions, oligomers, and multi-chain assemblies with unprecedented accuracy.

#Why Multimer Prediction Matters

Most proteins don't work alone—they form complexes to carry out biological functions. Understanding these interactions is crucial for:

• Drug discovery targeting protein-protein interfaces
• Understanding signaling pathways
• Designing protein-based therapeutics
• Elucidating molecular mechanisms

#AlphaFold2 vs. AlphaFold2-Multimer

When to Use Multimer

• Predicting heterodimers or homodimers
• Modeling larger oligomeric assemblies
• Studying protein-protein interaction interfaces
• Analyzing antibody-antigen complexes

#Preparing Your Input

Multi-Chain FASTA Format

For a heterodimer (two different chains):

>protein_A
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQ
>protein_B
GSSGSSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIQDESGLPQQ

For a homodimer (two identical chains), you can either:

>protein_A
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQ
>protein_A_copy
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQ

#Understanding ipTM Score

The ipTM (interface predicted Template Modeling score) is specific to multimer predictions and measures confidence in the protein-protein interface.

Interpreting ipTM

• ipTM > 0.8: Very high confidence in interface
• ipTM 0.6-0.8: Moderate confidence, interface likely correct
• ipTM < 0.6: Low confidence, interface may be incorrect

#Analyzing Protein Interfaces

Interface PAE Analysis

The PAE matrix for multimers shows critical information about chain-chain interactions:

• On-diagonal blocks: Intra-chain confidence (within each protein)
• Off-diagonal blocks: Inter-chain confidence (between proteins)

Identifying Interface Residues

Key residues at the interface typically have:

• High pLDDT scores (>80)
• Low PAE values to partner chain (<5Å)
• Buried surface area > 1000Ų for functional interfaces

#Validating Multimer Predictions

Essential Cross-Checks

• Model consistency: Do all 5 models predict similar interfaces?
• Biological relevance: Does the interface make sense functionally?
• Literature support: Are there experimental hints about interaction mode?
• Conservation: Are interface residues evolutionarily conserved?

Experimental Validation

#Common Challenges

Challenge: Multiple Possible Binding Modes

Some proteins can interact in multiple ways. Solutions:

• Compare all 5 models for alternative arrangements
• Use experimental constraints if available
• Consider biological context (cellular location, known function)

Challenge: Weak or Transient Interactions

Challenge: Large Complexes

For complexes with >1500 total residues:

• Consider predicting sub-complexes separately
• Use hierarchical assembly approach
• Increase computational resources/time

#Advanced Applications

Drug Discovery Applications

• Identifying druggable interfaces for PPI inhibitors
• Predicting antibody-antigen complexes
• Designing peptide inhibitors based on interface structure

Protein Design

• Engineering improved binding affinity
• Designing novel protein binders
• Creating synthetic protein assemblies

#Best Practices Summary